| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 10, CAS-V-A: 6, CAS-III-A: 1, CAS-III-D: 3, CAS-II-A: 17 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 3.45 |
| Mean length of the directons containing the candidates | 2.413793103448276 |
| Percent of cluster members that occur in self-targeting genomes | 11.11 |
| Number of members in the cluster | 29 |
| Model score for cluster | 0.2 |
| Consensus sequence | MSFRKYTKAIVICHGKSEKDFCDHIKSNLRLPIEIYSDKNGKKSIQITSINDILKNRDFK TKKCFKEKFFDVECDRKGNPNNFKIFIIMDVDDCNEEQKDSFKNSSMFVEHWKYDFIVPI WNDSNFEEVLNDVGYWYQKNGNERRH |
| Accessions (where available) / Location |
ERT35985.1 EEO42314.1 AKBT01000001.1:1256346-1256927:- EEW95333.1 ALF21788.1 ETZ26308.1 EPC07929.1 AGM23784.1 EHO79161.1 AKCE01000001.1:2118136-2118717:- LFSL01000073.1:49514-49828:+ EPT45425.1 EPV88686.1 EPT38228.1 KLL38799.1 EPV88374.1 KLL32500.1 ANPW01000048.1:6556-6996:+ EPV87239.1 EPX14782.1 ANPS01000048.1:6556-6996:+ EPT35684.1 ANCL01000078.1:1149-1589:+ ANPY01000035.1:12436-12858:- KLJ68540.1 EPV07296.1 EGS26987.1 EGS26988.1 LFSL01000073.1:49233-49514:+ |