CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 20, CAS-I-C: 4, CAS-II-C: 5, CAS-III-B: 11, CAS-I-B, CAS-III-B: 4, CAS-III-B, CAS-I-B: 1, CAS-I-B, CAS-III-C: 1, CAS-III-D: 2, CAS-I-C, CAS-I: 1, CAS-III: 2 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 3.57 |
Mean length of the directons containing the candidates | 1.607142857142857 |
Percent of cluster members that occur in self-targeting genomes | 53.57 |
Number of members in the cluster | 28 |
Model score for cluster | 0.53 |
Consensus sequence | MEKNEGPLPELMPPEFRVSTDFHFEQWFMNEETYAGDSVGEHTALEQANEYLAEKEIGQT FENS |
Accessions (where available) / Location |
JYCF01000120.1:19176-19502:+ AEH49025.1 GAJ39555.1 AMRO01000053.1:11411-11617:+ GAD13790.1 ACX78121.1 ADU93096.1 GAJ60029.1 JALS01000005.1:71207-71401:- ESU72436.1 BCPV01000033.1:29009-29203:+ JQMN01000001.1:1144898-1145092:+ JYCG01000312.1:39006-39200:- ALA70967.1 KFX34111.1 LDPD01000008.1:126304-126498:+ KJE26856.1 ADI27826.1 JGCJ01000003.1:39080-39274:+ JFHZ01000139.1:30601-30795:+ KFL14986.1 KPC99337.1 BBJV01000019.1:41708-41902:- ALF09738.1 KJX70439.1 GAJ42676.1 ACS23559.1 JYCE01000061.1:187247-187450:- |