| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 21, CAS-III-D: 13, CAS-III-A: 2 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 14.29 |
| Mean length of the directons containing the candidates | 1.25 |
| Percent of cluster members that occur in self-targeting genomes | 17.86 |
| Number of members in the cluster | 28 |
| Model score for cluster | 0.43 |
| Consensus sequence | MNFKFHFLSVFREFFIPHHRSLEFRAKIFAAMLCAKKDVDEDDYNDLKDIANEIYANDER RVGVLIQTVKEYVSKVKEYDYITLDSLLLDIDRDLKNHKRYAKKIDFSHLRRLMIDSDED DALIQQRVYEFFLNEVKRYS |
| Accessions (where available) / Location |
ERJ29778.1 ERJ30405.1 EET78612.1 EHL89321.1 ERJ31981.1 EAT99088.1 AQXN01000008.1:221932-222366:+ ERJ24225.1 ABS51474.1 CDF63927.1 AJSG01000001.1:107017-107439:+ ALV23626.1 AGZ80902.1 AII13887.1 JYCP01000002.1:113575-113997:+ AIR77969.1 ALV63998.1 KEA44038.1 AJMC01000001.1:66564-66986:+ AJB44659.1 AHE93361.1 AIR79684.1 ABK82069.1 EEV16669.1 AKT91485.1 ASTK01000035.1:1529-1819:- EPH10134.1 KB894734.1:94050-94475:+ |