| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 6, CAS-II-A: 27, CAS-II-C: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 3.57 |
| Mean length of the directons containing the candidates | 1.928571428571429 |
| Percent of cluster members that occur in self-targeting genomes | 10.71 |
| Number of members in the cluster | 28 |
| Model score for cluster | 0.6 |
| Consensus sequence | MNEIENKLEELEEMVINMDEVDVVIPWKIAKNLLQRAGYLSEEEHRLLSWRLGKSKYAGK RSEKVRNLLEGLRNSGSSENS |
| Accessions (where available) / Location |
YP_009191679.1 ATXR01000013.1:48394-48657:+ AKG27826.1 KGE59747.1 APMZ01000025.1:33404-33649:- EZL77523.1 EZK92814.1 ESA58711.1 AIG47167.1 EZN32486.1 AAM79577.1 BAC63979.1 AMA70444.1 EZK80512.1 AWPB01000012.1:47721-47966:+ EZN36124.1 AIT77623.1 AKI38572.1 EZL50096.1 EZL80821.1 EZL72712.1 AKL63221.1 AIG49017.1 AKZ52295.1 ESU89897.1 EZK72826.1 AKJ92502.1 EZK87261.1 |