| CRISPR-Cas subtypes that co-occur with the candidate | CAS-II-A: 25, CAS-II-C: 1, CAS-I-C: 4, CAS-I-E: 3 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 7.14 |
| Mean length of the directons containing the candidates | 4.0 |
| Percent of cluster members that occur in self-targeting genomes | 3.57 |
| Number of members in the cluster | 28 |
| Model score for cluster | 0.56 |
| Consensus sequence | MEITKVFVDQNEVLGNEVFVSGMEEVRANDYNPVSYRIFEISSRKEPSAFLIVEGFKMSD VPEGRQKVVFPRGIAIERRNFRFGGKRKHENVIVAEEMRVVKSK |
| Accessions (where available) / Location |
KL370862.1:1295542-1295862:- BAK27191.1 KLL56072.1 EPW10294.1 EJP25213.1 KXT63880.1 KUM01544.1 AOSD01000014.1:19113-19427:+ EPV56008.1 EPT94044.1 KLJ20119.1 EMP65325.1 EMB84206.1 AQWT01000006.1:78241-78555:- ANQU01000021.1:9783-10097:+ KLL37918.1 KLK55502.1 AUKZ01000011.1:38959-39273:+ EPU89123.1 EMB84087.1 EMB76040.1 ESS18700.1 EMC53086.1 AAN57982.1 EMC18234.1 AJD54651.1 EMP60254.1 EMC33398.1 |