| CRISPR-Cas subtypes that co-occur with the candidate | CAS-II-C: 2, CAS-I-C: 22, CAS-VI-A: 1, CAS-I-B: 2, CAS-III: 1, CAS-III-D: 3, CAS-I-C, CAS-III-D: 1, CAS-II-A: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 3.57 |
| Mean length of the directons containing the candidates | 4.535714285714286 |
| Percent of cluster members that occur in self-targeting genomes | 24.0 |
| Number of members in the cluster | 28 |
| Model score for cluster | 0.25 |
| Consensus sequence | MKKHGHYCKVCGEYKANEKFSGKGHAAHICKSCASLPPEKQAELMTLNRLLNLPWRLSKE QLSWLKNRMKDRRPEVRELAQEQYEMRFPPRWHLEDDDFDFFDEEDFIE |
| Accessions (where available) / Location |
LN877918.1:257160-257912:- EHL73056.1 ENZ48705.1 CBK76294.1 AUJF01000032.1:25146-25496:+ CCZ34762.1 ENZ20457.1 ENZ06868.1 ENZ60026.1 CRL39738.1 ENZ45973.1 BAHQ02000522.1:27445-27771:- BAIL02000004.1:130057-130383:- BAHR02000147.1:96807-97133:- BBZQ01000028.1:10558-10884:+ BAID02000237.1:38330-38656:- BAIJ02000020.1:20256-20582:+ EHO30897.1 BAIG01000023.1:20121-20447:+ EEF67405.1 EHF03385.1 BAHY01000005.1:41973-42299:+ BBZM01000068.1:1923-2243:- ENZ45714.1 ENZ49536.1 BBZQ01000070.1:4420-4728:- EFE14200.1 EOS71305.1 |