Cluster: cluster_38996

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 3
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 66.67
Mean length of the directons containing the candidates 4.333333333333333
Percent of cluster members that occur in self-targeting genomes 66.67
Number of members in the cluster 3
Model score for cluster 0.26
Consensus sequence MNPKEKDNEIIELTDEELNEIFADDDFDNGGEDGEIRSFYFSNPDPYAKVKPRPDDAPKR
EFSFDDKGNIVVKNPSAYWLPDIKIVDEHGGTEYTVTGSYEGTEPLDRKLRRIMEQNATD
DKNGITEDADE
Accessions (where available) / Location ALP93408.1
HE998567.1:1620494-1620757:-
EOS66444.1