CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 23, CAS-III-B: 7, CAS-III-B, CAS-III: 1, CAS-III-D: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 3.85 |
Mean length of the directons containing the candidates | 2.192307692307693 |
Percent of cluster members that occur in self-targeting genomes | 18.75 |
Number of members in the cluster | 26 |
Model score for cluster | 0.59 |
Consensus sequence | MTKTLMNMNKKEKDEVNIESIAELVFLPNTIDSIKNFQNNIKAYGYLENMLGIFNNIKKA EAYKEVYNDIKSMIAKNDLEDLMSFHQKLMGYTKSEEERTIVNTLFMCIMHQCNKDLGLY NLD |
Accessions (where available) / Location |
AJE13461.1 LFPH01000007.1:224254-224625:- ACA57488.1 AJD29301.1 AZQW01000513.1:699-1067:+ ACQ51405.1 EPS54496.1 KIS21543.1 AZQW01000074.1:5956-6321:- AZRQ01000036.1:6078-6443:+ LAGI01000504.1:3943-4299:+ ACA46961.1 AJD29303.1 EPS54510.1 AJE13304.1 KEI95007.1 ACA57437.1 LAGD01000252.1:1538-1885:- BAO05121.1 BAO05100.1 LFPH01000007.1:223568-223936:- KIS21541.1 LFPK01000006.1:69032-69400:- AJE13469.1 LAGO01000118.1:3141-3509:+ ACA57470.1 |