Cluster: cluster_39936

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 3
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 66.67
Mean length of the directons containing the candidates 2.666666666666667
Percent of cluster members that occur in self-targeting genomes 33.33
Number of members in the cluster 3
Model score for cluster 0.21
Consensus sequence MKKKNKQNLLPKEFQQFEILTERKLEQVTGGDHRHRINNSIWRWIFFGRK
Accessions (where available) / Location EGP67193.1
KXT70187.1
KXC03336.1