| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-F: 2, CAS-I-E: 23 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 3.85 |
| Percentage of cluster members that are adjacent to an HTH protein | 3.85 |
| Mean length of the directons containing the candidates | 4.076923076923077 |
| Percent of cluster members that occur in self-targeting genomes | 23.08 |
| Number of members in the cluster | 26 |
| Model score for cluster | 0.58 |
| Consensus sequence | MAFVSQREFAIKALGREAEQPNVVFRKSKSGSAGGRFNKSCPFGGHRIDFQIDEHNKKIR IGADDNGLSVHKGTGQFSCSKEVFKIIGPQRIFLTEGDDGWWYGSYD |
| Accessions (where available) / Location |
KMK13563.1 AIT04815.1 EMH90898.1 KPR17356.1 FBRA01000013.1:9167-9490:+ KOR05393.1 KJP82011.1 YP_004327357.1 ETC52724.1 ETB82182.1 ETC28487.1 ETC25367.1 ETC45462.1 ETB90419.1 ETB94432.1 ETC06049.1 ETC58261.1 ETB77277.1 ESH20092.1 CCF90700.1 ETB97159.1 ETC23440.1 ETC12227.1 ETC37114.1 ALI13690.1 ETC16347.1 |