| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 15, CAS-I-C: 21, CAS-I-E: 4, CAS-IV-A: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 4.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 24.0 |
| Mean length of the directons containing the candidates | 3.92 |
| Percent of cluster members that occur in self-targeting genomes | 44.0 |
| Number of members in the cluster | 25 |
| Model score for cluster | 0.57 |
| Consensus sequence | MEASLKFLIGLTAISVVSVFYFLQWLHGRSEDYDADDLIQKWSHIRKSYLTQEDAALKAA NSQTDKAKNTKPVSFLDPTKRHKGQ |
| Accessions (where available) / Location |
JQOT01000065.1:10850-11131:+ AOWO01000133.1:16991-17272:+ AHQM01000039.1:1992-2270:+ AOUX01000107.1:33015-33293:- AOWP01000117.1:50889-51167:- JQQU01000038.1:26458-26736:- JQPC01000075.1:31414-31692:- JQQW01000155.1:5540-5818:+ JQQV01000078.1:222-500:- AOWQ01000020.1:36028-36306:- AHQN01000429.1:5625-5903:+ AHQD01000005.1:19832-20110:+ JQOZ01000014.1:47936-48214:- EMN60342.1 KGE21785.1 EMJ55944.1 EMN38357.1 EMO78568.1 EMK02965.1 EKR34378.1 AHQK01000062.1:3489-3740:- EKR89702.1 EMO43809.1 JQRD01000099.1:4232-4480:+ EMO50707.1 |