CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 21, CAS-I-F: 3 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 4.17 |
Mean length of the directons containing the candidates | 3.125 |
Percent of cluster members that occur in self-targeting genomes | 16.67 |
Number of members in the cluster | 24 |
Model score for cluster | 0.3 |
Consensus sequence | MTISLISARNRVKQAEAVLGAWLESPRDDYEATLISAIITLIEGVEESIKEADTKLDSLI K |
Accessions (where available) / Location |
KFU59822.1 KFU73568.1 KDQ91288.1 KFU70049.1 KFT87062.1 ESH42159.1 ESG22600.1 ARYS01000018.1:50489-50674:- ESG89884.1 ELX51832.1 EHL58866.1 ARYW01000127.1:6333-6518:+ KSB21560.1 ARYX01000037.1:132405-132590:- ESJ20946.1 ELX60079.1 AGR59225.1 AMG28551.1 ALPQ01000006.1:46598-46732:+ KDP99100.1 AXSZ01000040.1:7296-7481:+ KLP34500.1 KTK72849.1 KXB45691.1 |