| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 21, CAS-II-A: 16 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 100.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
| Mean length of the directons containing the candidates | 3.958333333333333 |
| Percent of cluster members that occur in self-targeting genomes | 75.0 |
| Number of members in the cluster | 24 |
| Model score for cluster | 0.96 |
| Consensus sequence | MSKTMYKNDVIELIKNAKTNNEELLFTSVERNTREAATQYFRCPEKHVSDAGVYYGEDFE FDGFEIFEDDLIYTRSYDKEELN |
| Accessions (where available) / Location |
CWLB01000128.1:1621-1881:+ CWMY01000300.1:1125-1385:- CWKM01000037.1:1213-1473:- CWKX01000040.1:2541-2801:- CWLD01000056.1:825-1085:- AGR27296.1 YP_001468864.1 KTA63901.1 EFK41084.1 KHK17522.1 KHK19908.1 KTA28091.1 AGR15692.1 CDM19870.1 KHK12399.1 KTA68178.1 EEW20425.1 KHK04754.1 KKD43687.1 ALU78084.1 CWLK01000032.1:1065-1304:+ CWKQ01000006.1:37187-37426:- CWKV01000004.1:37290-37529:- CWMF01000013.1:822-1061:- |