CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 2, CAS-II-A: 17, CAS-II-C: 8, CAS-III-A: 4, CAS-I-C: 4 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 10.0 |
Percentage of cluster members that are adjacent to an HTH protein | 43.48 |
Mean length of the directons containing the candidates | 3.173913043478261 |
Percent of cluster members that occur in self-targeting genomes | 30.0 |
Number of members in the cluster | 23 |
Model score for cluster | 0.18 |
Consensus sequence | MSTVVGDLSLTSRENQIGSLFFDVQSDEDFFFKVVKVPETKSLAFDVLDEMIGLF |
Accessions (where available) / Location |
EWM59373.1 EWM57599.1 ALX90517.1 ETW90014.1 ALD17027.1 EWM61753.1 EWM57685.1 EWM60236.1 ATXR01000008.1:92943-93152:+ BAQ50638.1 ESU92246.1 AKG28851.1 ETS96893.1 JWEZ01000047.1:8659-8826:+ EUC75947.1 EWC98427.1 EUB16234.1 GAD35900.1 GAD39956.1 EFW07224.1 KB891974.1:132721-132888:- ALL03705.1 ALL03698.1 |