| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 21, CAS-IV-A: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 4.55 |
| Mean length of the directons containing the candidates | 3.363636363636364 |
| Percent of cluster members that occur in self-targeting genomes | 36.36 |
| Number of members in the cluster | 22 |
| Model score for cluster | 0.71 |
| Consensus sequence | MDEKTLELLREIQESIKILNDKLDEFDYTQDKIKSNVEGLLECFSRIDFRIEDLENGQTS LYTKLDIVQNETAKSIK |
| Accessions (where available) / Location |
EQL11863.1 EQF07389.1 EQE22700.1 EQE71580.1 EQE72004.1 EQJ88739.1 EQH27395.1 AKP44843.1 AUOX01000031.1:4462-4695:- YP_009221771.1 EQL04532.1 ADEJ01000893.1:36811-37044:+ CCL66984.1 EQJ06305.1 EQJ49086.1 ABHD02000059.1:6134-6367:- EQG33576.1 EQJ51287.1 EQE50986.1 AQWV01000058.1:60548-60781:- CCL12278.1 EQI89716.1 |