| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-F: 11, CAS-I-E: 7, CAS-III-A: 6, CAS-I-C: 3, CAS-II-C: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 9.09 |
| Percentage of cluster members that are adjacent to an HTH protein | 13.64 |
| Mean length of the directons containing the candidates | 2.1818181818181817 |
| Percent of cluster members that occur in self-targeting genomes | 27.27 |
| Number of members in the cluster | 22 |
| Model score for cluster | 0.6 |
| Consensus sequence | MYTYKMVQVPPNISVNAKDNKNNAAADYLEEVVNEYAEEGWEFQRIDTFGVEEQPGCFGG GKSTVRHYYVITFRKEV |
| Accessions (where available) / Location |
AZOD01000009.1:100271-100528:+ ESL29842.1 CM001972.1:2529906-2530136:+ CM001980.1:2417836-2418066:+ KQJ40962.1 AEJ59635.1 YP_009113096.1 EII47786.1 KHH26528.1 AHK21391.1 AJK14549.1 BCTD01000023.1:41895-42137:+ CBLI010000533.1:538-756:+ ABS49522.1 CBLG010000113.1:2289-2507:- EEP92562.1 EGT77549.1 AEC16233.1 KGQ50098.1 KGQ46364.1 KGQ64949.1 EIJ72133.1 |