| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 20, CAS-I-C: 3, CAS-III-D, CAS-I-B: 1, CAS-I-B, CAS-III-D: 2, CAS-I-B: 8 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 4.76 |
| Mean length of the directons containing the candidates | 2.619047619047619 |
| Percent of cluster members that occur in self-targeting genomes | 25.0 |
| Number of members in the cluster | 21 |
| Model score for cluster | 0.39 |
| Consensus sequence | MSGGERKQSYTHLGLHVGADWSVTCHTYPDRAPILAVDAGRVSLSVSAMGNAPDADHVDF AYKLLAAVNDYLIACERFRFESQEAADSTGPRAA |
| Accessions (where available) / Location |
KFB06084.1 KDA42971.1 ETA03100.1 EYT92061.1 ABD10520.1 ABW14686.1 EFC83298.1 KPM54781.1 KQM04757.1 KJE25399.1 CAJ60384.1 KQM03506.1 KJE21500.1 EFC85957.1 KJE20053.1 KQC35713.1 KQM02352.1 KFB06894.1 ETA03996.1 CAJ64082.1 KPM54690.1 |