CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 20, CAS-I-B: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 90.0 |
Mean length of the directons containing the candidates | 3.95 |
Percent of cluster members that occur in self-targeting genomes | 15.0 |
Number of members in the cluster | 20 |
Model score for cluster | 0.16 |
Consensus sequence | MRQGGEMMEELPARVKKISENFISDMQSYYPWPGIDDDFALETRPKYDANNQACLDLLTA IGGAFTGLRHAVLSNSRHIEGVSSDARDEIDRQMSSLDTPDDSSQGGRH |
Accessions (where available) / Location |
KOG81176.1 JNYP01000008.1:474005-474370:+ JOCW01000029.1:40644-40973:- JOFG01000014.1:87323-87652:- JOIH01000002.1:308324-308653:- JOFE01000022.1:40644-40973:- JOIP01000007.1:200635-200964:- JODO01000032.1:40441-40770:- JOHA01000001.1:308186-308515:- JOFF01000004.1:86310-86639:+ JOIO01000011.1:149534-149863:- JNZZ01000025.1:9417-9746:- JOAC01000003.1:313229-313558:- KOU49730.1 JOHD01000037.1:13581-13910:- JODK01000016.1:87120-87449:- KOU07455.1 JOBG01000015.1:79360-79689:- JOFD01000019.1:40644-40973:- JNXB01000020.1:86974-87303:- |