| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 5, CAS-III-A: 1, CAS-III-D: 1, CAS-I-F: 1, CAS-I-E: 9, CAS-II-A: 1, CAS-I-B: 4 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 5.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 5.0 |
| Mean length of the directons containing the candidates | 1.45 |
| Percent of cluster members that occur in self-targeting genomes | 5.0 |
| Number of members in the cluster | 20 |
| Model score for cluster | 0.69 |
| Consensus sequence | DAYMTNNYMNDMERYSQEYVEPEDYNLANDFYERLVCWINDFEKELEDEHEVGGRLVSFG KNIQFNIQDIGYWNPNLIVFYGELEDGSPVELVQHVSQINFLLIAVKRKNPEEPKRPIGF ADWGEEDSFKGDN |
| Accessions (where available) / Location |
KMO87918.1 KXA68719.1 ERT60233.1 AMZI01000011.1:180778-181215:- EIW31409.1 EIW18570.1 AKP84956.1 AYQZ01000101.1:3965-4381:- AYQX01000204.1:3760-4176:- AIAZ01000079.1:3874-4290:- AGC87667.1 KXP21401.1 CCJ44693.1 CCK47418.1 AELE01000017.1:123480-123644:- ERK67030.1 KRU14444.1 ELP58940.1 AJA49543.1 AJA53531.1 |