Cluster: cluster_5240

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 18, CAS-II-C: 2
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 55.0
Mean length of the directons containing the candidates 3.65
Percent of cluster members that occur in self-targeting genomes 25.0
Number of members in the cluster 20
Model score for cluster 0.39
Consensus sequence MNTTKVTMEQLQMRTDSYGAVLAYGDYVLASFYTWTKKDGYGNDAQVYRLTEQPIDGWGP
NARGRIECELELIAEADHLFEDAGHAIAWALAHIP
Accessions (where available) / Location AEI09241.1
EKU95812.1
LN881717.1:1310854-1311153:-
ATUF01000005.1:40178-40471:-
KWZ74438.1
ATUW01000001.1:87817-88110:-
LN881717.1:1380114-1380401:+
KTF03399.1
AEI09910.1
AEX77140.1
KWZ74258.1
ADH92263.1
EKU95744.1
EEW16105.1
JNKV01000052.1:1-120:-
KMY23640.1
EEJ54490.1
EFL93293.1
JWCP01000419.1:1544-1831:+
CZPX01000005.1:758084-758368:+