| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I, CAS-III: 1, CAS-I-C: 12, CAS-I-C, CAS-III-D: 1, CAS-II-A: 1, CAS-I-B: 3, CAS-I-E: 1, CAS-III-A: 2, CAS-III-D: 1, CAS-II-C: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 5.26 |
| Mean length of the directons containing the candidates | 3.3157894736842115 |
| Percent of cluster members that occur in self-targeting genomes | 15.79 |
| Number of members in the cluster | 19 |
| Model score for cluster | 0.39 |
| Consensus sequence | MKEIETFEEAVESGASFKDIGINSTLFWAYRTSKEAGNDLIDFNEVIWDYDIEEILKNCR KNGISEFTISSTFSSLIETLAEFEKQGCRMDGLTEVKARYTDWQTGEHALIPAIKMTVKE A |
| Accessions (where available) / Location |
KIR03797.1 EQJ61816.1 KGJ52451.1 EGB18625.1 EHO26966.1 AUEG01000001.1:476029-476400:- EFR38796.1 ETA80540.1 ABR50117.1 JNJN01000033.1:25915-26280:+ ENZ13259.1 HE978585.1:326321-326683:+ KQC86201.1 CUX39848.1 EFE46518.1 CABY01000005.1:194073-194435:- EOS73098.1 EOT27677.1 EEC56819.1 |