| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 19 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 94.74 |
| Mean length of the directons containing the candidates | 3.736842105263158 |
| Percent of cluster members that occur in self-targeting genomes | 68.42 |
| Number of members in the cluster | 19 |
| Model score for cluster | 0.66 |
| Consensus sequence | MREKKILDTIPKLQTLTESELDLIITAVDSCVVVQTLMNTKSPKDFTSKLSNLFEVGREN TKN |
| Accessions (where available) / Location |
EQJ92380.1 EQE20500.1 EQJ23897.1 EQJ22569.1 EQG76029.1 EQF24624.1 EQI78212.1 EQG93425.1 EQG29689.1 CM000659.1:1616124-1616315:+ EQI67313.1 EQI35263.1 EQH04424.1 EQH09344.1 EQE13955.1 EQK66333.1 CCL36862.1 EQH09093.1 EQG65308.1 |