| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 12, CAS-II-A: 6, CAS-II-C: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 94.44 |
| Percentage of cluster members that are adjacent to an HTH protein | 5.56 |
| Mean length of the directons containing the candidates | 2.055555555555556 |
| Percent of cluster members that occur in self-targeting genomes | 66.67 |
| Number of members in the cluster | 18 |
| Model score for cluster | 0.32 |
| Consensus sequence | MNIRYLSKNHKKAKLHDLEVTNKSITLDDFQLFGVTDFTIHSSAGDLTKLKLELLVKGRT YSEGGVK |
| Accessions (where available) / Location |
KEW09855.1 KEU61514.1 KEX05937.1 KET94746.1 KEV70564.1 KEV93234.1 KEW57825.1 KEW10432.1 KES97091.1 KEW09296.1 KET67347.1 CWNG01000209.1:3106-3303:- EXL13350.1 CWMP01000199.1:2457-2654:+ CWMR01000248.1:3125-3322:- CWNC01000080.1:4197-4394:+ CWMS01000009.1:34717-34914:- KKD43738.1 |