| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-A: 1, CAS-I-B: 15, CAS-I-C: 1, CAS-III-B, CAS-I-B: 1, CAS-I-B, CAS-III-B: 2, CAS-III-D: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 77.78 |
| Mean length of the directons containing the candidates | 3.333333333333333 |
| Percent of cluster members that occur in self-targeting genomes | 38.89 |
| Number of members in the cluster | 18 |
| Model score for cluster | 0.46 |
| Consensus sequence | MYNIFFSKHFLARHRHVQQLCSQLASLSEGTELHVHTNNETYYNAQFVQFDTQTKTLTII VDPFYEDGGKSMTINCRDIVAVEFPTEALVAASEEQTTTIGTTKTDDEDE |
| Accessions (where available) / Location |
JHVN01000005.1:40520-40855:+ JYCG01000191.1:3992-4315:- ADU93253.1 ACX78278.1 KGP61568.1 GAC91931.1 LIOK01000003.1:215574-215906:- ACJ34453.1 KIQ95322.1 ALJT01000048.1:14273-14605:+ KIP21684.1 EPZ38663.1 AKS37645.1 CUA79402.1 KN127220.1:218667-218996:+ KFZ43867.1 EMI10136.1 EMT46640.1 |