Cluster: cluster_6012

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 8, CAS-I-C: 12, CAS-II-C: 6, CAS-III-B: 1, CAS-III: 3, CAS-I-A: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 23.53
Mean length of the directons containing the candidates 3.294117647058824
Percent of cluster members that occur in self-targeting genomes 29.41
Number of members in the cluster 17
Model score for cluster 0.49
Consensus sequence MNIHEALKKIDWKKRMYFMWKFDIRFDQNIPPKSEEEFLRWVDRKTMNSFQNWERTDEYK
NLLMLYLESKMANDLEEIYDVVSEKAKQGDEKSVKLFLQLHKDINQNAKAAARTFNKQED
VQEEEDDDLEL
Accessions (where available) / Location CZIZ01000033.1:155-574:+
CZJP01000136.1:155-574:+
CZIN01000216.1:9825-10244:-
CZJA01000947.1:1339-1749:+
KGP61613.1
AKS37692.1
KJE27818.1
EHL78967.1
ABS21612.1
AFU12226.1
KLT15906.1
ETI68135.1
AKG35253.1
ASQQ01000600.1:12469-12861:-
JAGM01000040.1:31987-32334:-
HE610978.1:485504-485899:-
JATL01000002.1:94877-95266:+