| CRISPR-Cas subtypes that co-occur with the candidate | CAS-II-C: 2, CAS-III-A: 1, CAS-I-C: 10, CAS-III-D: 3, CAS-I-B: 3, CAS-V-A: 1, CAS-III: 2, CAS-III-A, CAS-I-C: 1, CAS-I-E: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 82.35 |
| Mean length of the directons containing the candidates | 2.117647058823529 |
| Percent of cluster members that occur in self-targeting genomes | 35.29 |
| Number of members in the cluster | 17 |
| Model score for cluster | 0.18 |
| Consensus sequence | MEKNKNQKKKVRFVVVREFSGDQTMQEAFEQLIERQTCEHFEEWLEHREMAQQAA |
| Accessions (where available) / Location |
EOT22608.1 EOS23959.1 EOS47379.1 EDS08818.1 EOS76096.1 ERI98518.1 BAIJ02000054.1:64056-64223:+ CBL08162.1 ENZ09030.1 ADO35239.1 BAK46957.1 KXA69910.1 EEA82193.1 EHO23019.1 EHM55471.1 EEC58528.1 JNJN01000020.1:3636-3797:+ |