| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 17 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
| Mean length of the directons containing the candidates | 4.117647058823529 |
| Percent of cluster members that occur in self-targeting genomes | 23.53 |
| Number of members in the cluster | 17 |
| Model score for cluster | 0.62 |
| Consensus sequence | MNQEKEKANDLLLKLELLKKINPQEFGYISGRIDVNIEKLKQESERNKSKKIRYRKGA |
| Accessions (where available) / Location |
EQE42473.1 EQG96005.1 EQF05460.1 EQI87046.1 EQH64806.1 EQK17111.1 EQF20145.1 EQH83274.1 EQH89358.1 EQF42041.1 EQH65888.1 EQE95083.1 EQH42445.1 CCL24287.1 EQE55839.1 ABHF02000060.1:41335-41511:- EQF59297.1 |