| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 14, CAS-III-D: 4, CAS-I-C: 2, CAS-III-C, CAS-I-B: 1, CAS-III-D, CAS-I-B: 3, CAS-I-D: 1, CAS-I-B, CAS-III-D: 1, CAS-III-B: 2, CAS-III-C: 1, CAS-III-C, CAS-III-C: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 29.41 |
| Mean length of the directons containing the candidates | 2.176470588235294 |
| Percent of cluster members that occur in self-targeting genomes | 7.14 |
| Number of members in the cluster | 17 |
| Model score for cluster | 0.53 |
| Consensus sequence | MYDNCFGSNGRNGCNILTVHKCLQDKCSFYKSTQELEEDRKKAYLLLAALPPDMQRYISD KYYNGKMPWAEGDCS |
| Accessions (where available) / Location |
ABN52865.1 ADU75426.1 CFX97150.1 BCMU01000005.1:123412-123642:- AEV70185.1 EMT39336.1 JHVU01000025.1:75292-75522:+ AEV70132.1 AEV70073.1 EFB39953.1 KI912455.1:71763-71990:+ BAZY01000005.1:46909-47124:+ CFX73574.1 AUCO01000004.1:125148-125369:+ APMH01000005.1:122586-122807:+ ARYO01000149.1:121659-121880:+ CDL92484.1 |