CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 15 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 87.5 |
Mean length of the directons containing the candidates | 4.6875 |
Percent of cluster members that occur in self-targeting genomes | 18.75 |
Number of members in the cluster | 16 |
Model score for cluster | 0.72 |
Consensus sequence | MICSNKEKVETALMIDYLKKNEPNEWRTIETIISSTYALSNFKKENKDIMNQK |
Accessions (where available) / Location |
EQE06268.1 EQE14608.1 YP_004306140.1 FN668944.1:4108577-4108744:- AQWV01000046.1:26708-26869:- ABHG02000043.1:33927-34088:- EQE72056.1 ABHD02000055.1:14930-15091:- EQJ02541.1 AUOX01000028.1:31782-31943:- CCL24284.1 EQL05010.1 EQJ74550.1 AKP44642.1 EQF28869.1 CCL16168.1 |