CRISPR-Cas subtypes that co-occur with the candidate | None (candidate detected solely in phages) |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 50.0 |
Mean length of the directons containing the candidates | 4.0 |
Percent of cluster members that occur in self-targeting genomes | 0.0 |
Number of members in the cluster | 2 |
Model score for cluster | 0.33 |
Consensus sequence | MTKQIIVMVATFASLIAIAVAGAIYEKRYHERNRNNRNSKGNKD |
Accessions (where available) / Location |
YP_009226524.1 YP_009226526.1 |