| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 15 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 6.25 |
| Percentage of cluster members that are adjacent to an HTH protein | 6.25 |
| Mean length of the directons containing the candidates | 3.5 |
| Percent of cluster members that occur in self-targeting genomes | 18.75 |
| Number of members in the cluster | 16 |
| Model score for cluster | 0.36 |
| Consensus sequence | MAKNTCLKRIQKMKMFMQIDRRIDVNGNSYLVRCEERPNGEWRVYDIDRKINISTMNKDT AFDEWKAEAKKQHNS |
| Accessions (where available) / Location |
YP_004934061.1 KNN62797.1 KNL95270.1 ESF85706.1 KNU06731.1 ESC06687.1 EHL59267.1 KNN44495.1 KHP84800.1 KIG35052.1 KXP20124.1 KHH76498.1 EGX09204.1 EYD92502.1 JWHN01000054.1:2386-2571:- AIBO01000166.1:38761-38946:- |