| CRISPR-Cas subtypes that co-occur with the candidate | CAS-II-A: 1, CAS-I-B: 15 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 6.25 |
| Mean length of the directons containing the candidates | 2.125 |
| Percent of cluster members that occur in self-targeting genomes | 100.0 |
| Number of members in the cluster | 16 |
| Model score for cluster | 0.17 |
| Consensus sequence | MKKFIVRFMKFASSLALSTAILSANSTCPWIIHQPKVPEEISNLKKTN |
| Accessions (where available) / Location |
EDM50870.1 CCL12367.1 EQI45024.1 CM000660.1:2878692-2878838:- EQF23551.1 EQI37748.1 EQE61913.1 EQG74514.1 FN665653.1:3063002-3063148:- EQE15510.1 EQH64560.1 KPI49247.1 EFH05660.1 EFH17057.1 EZR28771.1 KJF63776.1 |