| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 16, CAS-I-B, CAS-III-A: 2 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 6.25 |
| Mean length of the directons containing the candidates | 1.625 |
| Percent of cluster members that occur in self-targeting genomes | 37.5 |
| Number of members in the cluster | 16 |
| Model score for cluster | 0.52 |
| Consensus sequence | MSDYKLDINGNINLSDYSNIHDYLGIVGKDDKFSIKINCNDEDDMDIICSMLNNKGFDVI DKQQNEDGYYIYASKNN |
| Accessions (where available) / Location |
AJA49763.1 AJA53751.1 KRU14224.1 ELP57546.1 KAJ52202.1 KGI42137.1 KHO30882.1 KGI41555.1 LBNB01000035.1:3220-3444:+ KGI36580.1 KIG19712.1 CDI50853.1 KGI37202.1 AGX45306.1 CCXK01000014.1:623643-623876:- CCFF01000014.1:623643-623876:- |