CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 1, CAS-III, CAS-I-C: 1, CAS-I-C: 13, CAS-III-D: 4, CAS-II-C: 1, CAS-III-A: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 20.0 |
Mean length of the directons containing the candidates | 2.8 |
Percent of cluster members that occur in self-targeting genomes | 71.43 |
Number of members in the cluster | 15 |
Model score for cluster | 0.17 |
Consensus sequence | MKIMKLLLKILVAPVILVLTLFVWLCVGLIYISGLVLGLVSTVIALLGVAVLITYSPQNG IILLVMAFLISPMGLPLAAIWLLGKVQDLKYAIQNLVYG |
Accessions (where available) / Location |
EGN32946.1 ENZ30920.1 EHG31644.1 BAID02000237.1:40222-40521:- ENZ59096.1 ENZ14035.1 ENZ24397.1 LN877917.1:26681-26980:- ENZ61813.1 EDM99457.1 EEG55514.1 BAIJ02000054.1:106182-106463:+ BAIJ02000020.1:18390-18689:+ BAHY01000005.1:40107-40406:+ ADJT01007926:5408-5695:- |