| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 2, CAS-II-C: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 50.0 |
| Mean length of the directons containing the candidates | 4.5 |
| Percent of cluster members that occur in self-targeting genomes | 100.0 |
| Number of members in the cluster | 2 |
| Model score for cluster | 0.6 |
| Consensus sequence | MNEDWLERLEMLCERFSYLGIGADLQSHSLNELWGLYCHLSRLVDG |
| Accessions (where available) / Location |
ADZ25923.1 KB891329.1:49726-49866:- |