| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 14, CAS-I-F: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 6.67 |
| Mean length of the directons containing the candidates | 4.533333333333333 |
| Percent of cluster members that occur in self-targeting genomes | 14.29 |
| Number of members in the cluster | 15 |
| Model score for cluster | 0.39 |
| Consensus sequence | MSAEDEYAERFADLMEDMEGDGVDAMNIMMNWLMGFVEGMTEGEEDQGYIWQFEDKDMVI QIEPPEGTNAARLH |
| Accessions (where available) / Location |
AJLC01000162.1:27878-28138:- AWSP01000031.1:32705-32929:+ AHB71597.1 AHB69553.1 AJKV01000053.1:717-941:+ ALX78338.1 ABU78303.1 JPZF01000057.1:9089-9271:+ JZDO01000048.1:2784-2945:- AJLB01000117.1:20368-20529:+ KLG66167.1 EZE08511.1 JHRZ01000022.1:233275-233502:+ KJP82023.1 KLF56366.1 |