| CRISPR-Cas subtypes that co-occur with the candidate | CAS-III-A: 1, CAS-I-B: 6, CAS-III-D: 3, CAS-II-C: 1, CAS-I-B, CAS-III-B, CAS-III-B: 1, CAS-I-C: 5, CAS-III-B: 3, CAS-I-A: 3, CAS-I-C, CAS-I-C: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 46.67 |
| Mean length of the directons containing the candidates | 3.0 |
| Percent of cluster members that occur in self-targeting genomes | 6.67 |
| Number of members in the cluster | 15 |
| Model score for cluster | 0.29 |
| Consensus sequence | MTMMKLNPMEKYEPKVMEWIEDHFDMNEIQVEDFPIFPAGKLIRDENGHTMVVFWDVWYD RVDYTFPEA |
| Accessions (where available) / Location |
ADL07746.1 ACJ33161.1 GAC92340.1 KIQ93611.1 ESU70479.1 JHUR01000047.1:188296-188508:- JFHZ01000044.1:36223-36435:- ALJT01000013.1:336163-336351:+ KLR73834.1 CCDM010000006.1:123593-123796:- CCNM01000014.1:54433-54636:- LN868935.1:327411-327614:- KKE79191.1 CCFJ01000014.1:54433-54636:- BAXO01000028.1:54356-54472:- |