| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 5, CAS-I-E: 12, CAS-I-U: 7, CAS-I-B: 4 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 14.29 |
| Mean length of the directons containing the candidates | 1.1428571428571432 |
| Percent of cluster members that occur in self-targeting genomes | 71.43 |
| Number of members in the cluster | 14 |
| Model score for cluster | 0.72 |
| Consensus sequence | VATPSYDDENAVRSYPDEPHPGTANNNGDAKHIPTNKKETTIPMRIARIDTIPMTAEDLD NAAEALAVLLNHFRREHPDLA |
| Accessions (where available) / Location |
AZWS01000033.1:60762-61010:+ AUKM01000024.1:111714-111962:+ AUKT01000016.1:108658-108906:+ KB900614.1:2989412-2989657:+ KB897484.1:43693-43938:+ AZXH01000001.1:71992-72237:+ AZVZ01000043.1:21309-21554:- AZWG01000004.1:309043-309288:- JAEY01000052.1:1955-2200:- AZVD01000001.1:663362-663607:- KB896041.1:7692-7937:- AZVX01000009.1:5346-5591:+ AXVR01000045.1:9755-10000:- KI911529.1:23613-23858:+ |