CRISPR-Cas subtypes that co-occur with the candidate | CAS-III-D: 6, CAS-I-C: 7, CAS-I-B: 9, CAS-I-B, CAS-III-D: 1, CAS-II-C: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 7.14 |
Mean length of the directons containing the candidates | 2.785714285714286 |
Percent of cluster members that occur in self-targeting genomes | 7.14 |
Number of members in the cluster | 14 |
Model score for cluster | 0.77 |
Consensus sequence | MGDSLNKKLSELFGKMDDKMLQARINSAIDMLKNGDVDELAKKLNKIDKDELMEKINEFD ESKLKNLNINKDEIKQKITEADLDKLSKLLGEDGDEIMEKINDFLNKP |
Accessions (where available) / Location |
LFSL01000085.1:10174-10500:+ KNY27116.1 EIC04392.1 CDG36468.1 ALX09615.1 EFB37694.1 EEU00963.1 EMS71030.1 JHYD01000038.1:26591-26908:- EGD47444.1 BBAA01000005.1:109228-109542:- JAGE01000001.1:2231088-2231402:- AEY64672.1 ACL74743.1 |