Cluster: cluster_7171

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-D: 11, CAS-III-B: 14, CAS-III-D: 1, CAS-I-B: 5, CAS-I-U: 1, CAS-III-D, CAS-V-B: 1, CAS-III-A: 2
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 28.57
Mean length of the directons containing the candidates 2.214285714285713
Percent of cluster members that occur in self-targeting genomes 38.46
Number of members in the cluster 14
Model score for cluster 0.54
Consensus sequence MKIKVNQKKGSSNEVNPQLRDIAYSMDALIPGFYFWCPYFCWRLGGSDPDDNYPGTIHSF
AGISLVLPGYQIFTTYKGSYDPR
Accessions (where available) / Location KK073768.1:4713549-4713854:-
ANNX01000001.1:15681-15965:+
KOP23406.1
KE650773.1:18373-18621:+
EPF24855.1
EPF23626.1
CCH99657.1
CCI08279.1
KXS89973.1
GAL93777.1
AKV66431.1
CCI29426.1
AKE63634.1
CCI13923.1