| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 7, CAS-III-D: 1, CAS-I-E: 4, CAS-I-F: 1, CAS-IV-A: 1, CAS-III-A: 4, CAS-III-B: 1, CAS-III-D, CAS-III-A: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 7.69 |
| Percentage of cluster members that are adjacent to an HTH protein | 92.86 |
| Mean length of the directons containing the candidates | 3.785714285714286 |
| Percent of cluster members that occur in self-targeting genomes | 23.08 |
| Number of members in the cluster | 14 |
| Model score for cluster | 0.54 |
| Consensus sequence | MLDVQEMNDGPGTDDLGENGKPGRLSGEARLQSAASILATAILRRKAKNACVGNELEVFE DSSPVLGEGLDSLPEQSIHS |
| Accessions (where available) / Location |
ADK85207.1 ERS82936.1 ABB38730.1 EGW42543.1 EPR33939.1 AJF06853.1 ATVA01000013.1:142964-143206:- BCAG01000001.1:1025565-1025807:- KMY67357.1 AULM01000003.1:216448-216690:- ABK19447.1 JIAK01000016.1:2054-2296:+ BCAG01000005.1:465590-465832:- JOMG01000004.1:691134-691376:- |