| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-F: 14 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 21.43 |
| Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
| Mean length of the directons containing the candidates | 4.0 |
| Percent of cluster members that occur in self-targeting genomes | 50.0 |
| Number of members in the cluster | 14 |
| Model score for cluster | 0.16 |
| Consensus sequence | MLSVIRMLMLFMILLLIGAYVFGQFQNHHSDNVNPIPVVFCVLGTVSLTQN |
| Accessions (where available) / Location |
JVFD01000016.1:65001-65156:+ EGE26324.1 JVKW01000045.1:21272-21427:- EGE20161.1 EGE09671.1 JVAA01000052.1:20911-21066:- JVAC01000023.1:33550-33705:- EGE10279.1 JVKY01000032.1:33226-33381:- AIT43563.1 EGE20878.1 AIK00509.1 ADG61441.1 EGE19687.1 |