CRISPR-Cas subtypes that co-occur with the candidate | CAS-III-B: 3, CAS-I-E: 10, CAS-III-D: 5, CAS-I-B: 1, CAS-I-U: 2 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 7.14 |
Mean length of the directons containing the candidates | 3.285714285714286 |
Percent of cluster members that occur in self-targeting genomes | 40.0 |
Number of members in the cluster | 14 |
Model score for cluster | 0.31 |
Consensus sequence | MSDYPEDLSALTGPELVRAFLDAYDKPRTTPAERAEFFDFKARVFAAIADRDGNPDAARF AARARADRDRLWAEIEAQNGGGQR |
Accessions (where available) / Location |
ANAZ01000041.1:64751-65014:- LAVM01000010.1:79197-79460:- ANBF01000148.1:31340-31600:+ ANAZ01000003.1:10355-10615:- LAVM01000036.1:16656-16916:- ANBE01000003.1:305911-306171:- ANBA01000027.1:67962-68222:- ADH70668.1 ANAZ01000002.1:315307-315561:+ KB906872.1:59723-59977:+ BCRR01000042.1:9578-9832:+ LEKI01000007.1:65483-65737:- AZXF01000005.1:311617-311865:+ AZXF01000024.1:40480-40728:- |