| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 5, CAS-II-C: 4, CAS-III-D: 4, CAS-III-A: 2, CAS-I-B: 5, CAS-II-A: 2, CAS-III-B: 2, CAS-I-B, CAS-III-B: 1, CAS-I-B, CAS-III: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 7.14 |
| Mean length of the directons containing the candidates | 3.0 |
| Percent of cluster members that occur in self-targeting genomes | 28.57 |
| Number of members in the cluster | 14 |
| Model score for cluster | 0.59 |
| Consensus sequence | MTAEEYRNYLDTDFDDVKLEELPDIRKIRIDRNQTKEKRQAQYLRQVGNPYMVCVGNMKV KIRFANNGVSFEDAFENLLLSV |
| Accessions (where available) / Location |
EEG92595.1 EEU98872.1 JMLH01000037.1:26141-26389:- BAIK02000156.1:124891-125139:+ BAHW02000027.1:334131-334379:- BBZT01000007.1:48444-48692:+ CBK92292.1 CBL07392.1 CRL35868.1 BAHV02000016.1:6619-6867:- EEG37694.1 BAHP02000010.1:6301-6549:- EMZ19573.1 EOT27031.1 |