| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 9, CAS-I-B: 4, CAS-I-C, CAS-I-B: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
| Mean length of the directons containing the candidates | 2.0 |
| Percent of cluster members that occur in self-targeting genomes | 14.29 |
| Number of members in the cluster | 14 |
| Model score for cluster | 0.39 |
| Consensus sequence | MTWLKKNTHISILLGACLLFAAYLYITDPGDVNYAEIQIEHGDSLWSLAEQYRGKMSTDD WIKLVKTENELADIKIVAGKSLVIPVVSDQASPINTIEIARNEQ |
| Accessions (where available) / Location |
ACA39281.1 BBCN01000001.1:356676-357041:- JPDJ01000207.1:4713-5075:- JPDM01000373.1:10134-10496:- JPDK01000143.1:357014-357376:+ AJXM01000024.1:58222-58584:+ KMN40862.1 KGR81277.1 EFI66511.1 KOY82820.1 KGA82936.1 KOS62796.1 KEK09765.1 EKU43747.1 |