| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 10, CAS-III-B: 3, CAS-III-D: 3, CAS-I-C: 3, CAS-II-C: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 7.69 |
| Mean length of the directons containing the candidates | 1.6923076923076918 |
| Percent of cluster members that occur in self-targeting genomes | 16.67 |
| Number of members in the cluster | 13 |
| Model score for cluster | 0.44 |
| Consensus sequence | KGYLSQVKSNGRQYIYLCMYVGKQEYSTRKERRVYSFGEAEQALNKMYRWRRNFDEFPQE LLELGCGMEDLDEWIQTLETGYTKTGRKFIVNV |
| Accessions (where available) / Location |
KN127219.1:378379-378699:- AEH47115.1 KIQ93618.1 ACJ33166.1 JFHZ01000044.1:32672-32950:- KLR73832.1 ESU70482.1 ALJT01000013.1:340237-340479:+ GAC92348.1 BAZO01000058.1:6381-6635:+ EJR94476.1 EJS11354.1 EJR97199.1 |