| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 13 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
| Mean length of the directons containing the candidates | 2.0 |
| Percent of cluster members that occur in self-targeting genomes | 7.69 |
| Number of members in the cluster | 13 |
| Model score for cluster | 0.29 |
| Consensus sequence | MLLSGYIEIARLGAVPDVFYIWDYLGLGLIKKLYNIKIFKK |
| Accessions (where available) / Location |
EQI26074.1 EQG03677.1 EQF09159.1 EQI56218.1 EQG07485.1 EQI56355.1 EQF43915.1 EQI04333.1 EQE82077.1 EQJ21427.1 EQK19819.1 CCL06408.1 EQG41851.1 |