| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 10, CAS-III-B: 4, CAS-III-A: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 84.62 |
| Mean length of the directons containing the candidates | 2.8461538461538463 |
| Percent of cluster members that occur in self-targeting genomes | 7.69 |
| Number of members in the cluster | 13 |
| Model score for cluster | 0.4 |
| Consensus sequence | MKIALIYDNKDQDFSIFIDNENVINTDDDIVANELFNELRMLSNNCDNNLLQKKEVILSA ALYNTK |
| Accessions (where available) / Location |
ACA57565.1 KEI95036.1 LFPH01000007.1:208559-208759:- KIS21769.1 ACQ51183.1 AJE13334.1 AZQW01000050.1:19668-19868:- AJD29196.1 EPS54477.1 BAO05085.1 LFPJ01000009.1:17536-17736:+ KOY66101.1 AZRQ01000051.1:32621-32821:- |