| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 12 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
| Mean length of the directons containing the candidates | 4.083333333333333 |
| Percent of cluster members that occur in self-targeting genomes | 8.33 |
| Number of members in the cluster | 12 |
| Model score for cluster | 0.71 |
| Consensus sequence | MTDINKIREEIYRKLELLGPAKLKLALTKVDILKEIQDIEDENNIQN |
| Accessions (where available) / Location |
EQI22498.1 EQI60764.1 EQJ24499.1 EQH49291.1 EQF90163.1 EQG13341.1 EQE72880.1 EQG46181.1 EQI06770.1 EQF46831.1 EQG05417.1 EQE76098.1 |