CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 11, CAS-II-A: 9 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 75.0 |
Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
Mean length of the directons containing the candidates | 4.416666666666667 |
Percent of cluster members that occur in self-targeting genomes | 66.67 |
Number of members in the cluster | 12 |
Model score for cluster | 0.65 |
Consensus sequence | MIFTVNSFPQSGHVFTPGLTVNTCEHSGQVPSVPFLIISSLAIFRLCSLICLSNFFESNL ILTPILPTSLHKNYNTVKGRTERRTKCQIYK |
Accessions (where available) / Location |
EEW20564.1 KPV85513.1 KID22408.1 KID19118.1 KID20101.1 AEO07300.1 KKB87536.1 KID27045.1 EFG00234.1 AEO04738.1 KHS60316.1 KHS59258.1 |